Recombinant Human HPCA Protein, GST-tagged

Cat.No. : HPCA-5003H
Product Overview : Human HPCA full-length ORF ( NP_002134, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. This protein is associated with the plasma membrane. It has similarities to proteins located in the photoreceptor cells that regulate photosignal transduction in a calcium-sensitive manner. This protein displays recoverin activity and a calcium-dependent inhibition of rhodopsin kinase. It is identical to the rat and mouse hippocalcin proteins and thought to play an important role in neurons of the central nervous system in a number of species. [provided by RefSeq
Molecular Mass : 46.86 kDa
AA Sequence : MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSPGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSRSQF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HPCA hippocalcin [ Homo sapiens ]
Official Symbol HPCA
Synonyms HPCA; hippocalcin; neuron-specific calcium-binding protein hippocalcin; calcium-binding protein BDR-2; neuron specific calcium-binding protein hippocalcin; BDR2;
Gene ID 3208
mRNA Refseq NM_002143
Protein Refseq NP_002134
MIM 142622
UniProt ID P84074

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HPCA Products

Required fields are marked with *

My Review for All HPCA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon