Recombinant Human HOXD4

• Cat.No.: HOXD4-26695TH
• Product Overview: Recombinant fragment of Human HOXD4 with a N terminal proprietary tag; Predicted MWt 32.45kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 62 amino acids
• Description: This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5 end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined.
• Molecular Weight: 32.450kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPF
• Sequence Similarities: Belongs to the Antp homeobox family. Deformed subfamily.Contains 1 homeobox DNA-binding domain.

Gene Information

• Gene Name: HOXD4 homeobox D4 [ Homo sapiens ]
• Official Symbol: HOXD4
• Synonyms: HOXD4; homeobox D4; homeo box D4 , HOX4, HOX4B; homeobox protein Hox-D4
• Gene ID: 3233
• mRNA Refseq: NM_014621
• Protein Refseq: NP_055436
• Uniprot ID: P09016
• Chromosome Location: 2q31.1
• Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity