Recombinant Human HOXC5 Protein, GST-tagged

Cat.No. : HOXC5-4981H
Product Overview : Human HOXC5 full-length ORF ( NP_061826.1, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC5, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5 non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants have been described for HOXC5. The transcript variant which includes the shared exon apparently doesnt encode a protein. The protein-coding transcript variant contains gene-specific exons only. [provided by RefSeq
Molecular Mass : 51.4 kDa
AA Sequence : MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPRAHPDRPACSAAAAPGHAPGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKEAL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HOXC5 homeobox C5 [ Homo sapiens ]
Official Symbol HOXC5
Synonyms HOXC5; homeobox C5; homeo box C5 , HOX3, HOX3D; homeobox protein Hox-C5; homeo box C5; homeobox protein CP11; homeobox protein Hox-3D; CP11; HOX3; HOX3D;
Gene ID 3222
mRNA Refseq NM_018953
Protein Refseq NP_061826
MIM 142973
UniProt ID Q00444

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HOXC5 Products

Required fields are marked with *

My Review for All HOXC5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon