Recombinant Human HOXC12 Protein, GST-tagged

Cat.No. : HOXC12-4976H
Product Overview : Human HOXC12 partial ORF ( NP_776272, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLSWPSAEPCNGYPQPYLGSPVSLNPPFGRTCELARVEDGKGYYREPCA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HOXC12 homeobox C12 [ Homo sapiens ]
Official Symbol HOXC12
Synonyms HOXC12; homeobox C12; HOC3F, homeo box C12 , HOX3, HOX3F; homeobox protein Hox-C12; homeo box 3F; homeo box C12; homeobox protein Hox-3F; HOX3; HOC3F; HOX3F;
Gene ID 3228
mRNA Refseq NM_173860
Protein Refseq NP_776272
MIM 142975
UniProt ID P31275

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HOXC12 Products

Required fields are marked with *

My Review for All HOXC12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon