Recombinant Human HOXB5

• Cat.No.: HOXB5-28512TH
• Product Overview: Recombinant fragment of Human HOXB5 with an N terminal proprietary tag; Predicted MWt 36.41 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 98 amino acids
• Description: This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue.
• Molecular Weight: 36.410kDa inclusive of tags
• Tissue specificity: Spinal cord.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAF
• Sequence Similarities: Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain.

Gene Information

• Gene Name: HOXB5 homeobox B5 [ Homo sapiens ]
• Official Symbol: HOXB5
• Synonyms: HOXB5; homeobox B5; homeo box B5 , HOX2, HOX2A; homeobox protein Hox-B5
• Gene ID: 3215
• mRNA Refseq: NM_002147
• Protein Refseq: NP_002138
• MIM: 142960
• Uniprot ID: P09067
• Chromosome Location: 17q21.32
• Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity