Recombinant Human HOXB3

Cat.No. : HOXB3-28511TH
Product Overview : Recombinant fragment of Human Hoxb3 with an N terminal proprietary tag; Predicted MWt 36.52 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML).
Molecular Weight : 36.520kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TAGFMNALHSMTPSYESPSPPAFGKAHQNAYALPSNYQPPLKGCGAPQKYPPTPAPEYEPHVLQANGGAYGTPTMQGSPVYVGGGGYADPLPPPAGPSL
Sequence Similarities : Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name HOXB3 homeobox B3 [ Homo sapiens ]
Official Symbol HOXB3
Synonyms HOXB3; homeobox B3; homeo box B3 , HOX2, HOX2G; homeobox protein Hox-B3;
Gene ID 3213
mRNA Refseq NM_002146
Protein Refseq NP_002137
MIM 142966
Uniprot ID P14651
Chromosome Location 17q21.32
Function sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HOXB3 Products

Required fields are marked with *

My Review for All HOXB3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon