Recombinant Human HOXA6 Protein, GST-tagged

• Cat.No.: HOXA6-4948H
• Product Overview: Human HOXA6 full-length ORF ( NP_076919.1, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 52.7 kDa
• AA Sequence: MSSYFVNPTFPGSLPSGQDSFLGQLPLYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDSEAKAGE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HOXA6 homeobox A6 [ Homo sapiens ]
• Official Symbol: HOXA6
• Synonyms: HOXA6; homeobox A6; homeo box A6 , HOX1, HOX1B; homeobox protein Hox-A6; homeo box 1B; homeo box A6; homeobox protein HOXA6; homeobox protein Hox-1B; HOX1; HOX1B; HOX1.2
• Gene ID: 3203
• mRNA Refseq: NM_024014
• Protein Refseq: NP_076919
• MIM: 142951
• UniProt ID: P31267