Recombinant Human HOXA5

Description :	In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis.
Protein length :	90 amino acids
Molecular Weight :	35.530kDa inclusive of tags
Source :	Wheat germ
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	YGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSD
Sequence Similarities :	Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain.
Tag :	Non

Gene Name	HOXA5 homeobox A5 [ Homo sapiens ]
Official Symbol	HOXA5
Synonyms	HOXA5; homeobox A5; homeo box A5 , HOX1, HOX1C; homeobox protein Hox-A5;
Gene ID	3202
mRNA Refseq	NM_019102
Protein Refseq	NP_061975
MIM	142952
Uniprot ID	P20719
Chromosome Location	7p15.2
Function	DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;