Recombinant Human HOXA4 Protein, GST-tagged

• Cat.No.: HOXA4-4945H
• Product Overview: Human HOXA4 partial ORF ( NP_002132, 181 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. [provided by RefSeq
• Molecular Mass: 35.64 kDa
• AA Sequence: DKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HOXA4 homeobox A4 [ Homo sapiens ]
• Official Symbol: HOXA4
• Synonyms: HOXA4; homeobox A4; homeo box A4 , HOX1, HOX1D; homeobox protein Hox-A4; homeo box A4; Dfd-like protein; Hox-1.4-like protein; homeobox protein Hox-1D; homeobox protein Hox-1.4; HOX1; HOX1D
• Gene ID: 3201
• mRNA Refseq: NM_002141
• Protein Refseq: NP_002132
• MIM: 142953
• UniProt ID: Q00056