Recombinant Human HOXA10 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : HOXA10-5973H
Product Overview : HOXA10 MS Standard C13 and N15-labeled recombinant protein (NP_061824) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor that may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the downstream homeobox A9 (HOXA9) gene.
Molecular Mass : 40.5 kDa
AA Sequence : MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPPAADLPYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLDAPRSCRMEPPDGPPPPPQQQPPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGYGSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFSSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HOXA10 homeobox A10 [ Homo sapiens (human) ]
Official Symbol HOXA10
Synonyms HOXA10; homeobox A10; homeo box A10, HOX1, HOX1H; homeobox protein Hox-A10; homeo box A10; homeobox protein 1H; homeobox protein HOXA10; homeobox protein Hox-1H; homeobox protein Hox-1.8; PL; HOX1; HOX1H; HOX1.8; MGC12859;
Gene ID 3206
mRNA Refseq NM_018951
Protein Refseq NP_061824
MIM 142957
UniProt ID P31260

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HOXA10 Products

Required fields are marked with *

My Review for All HOXA10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon