Recombinant Human HNRNPL Protein (89-335 aa), His-SUMO-tagged

• Cat.No.: HNRNPL-558H
• Product Overview: Recombinant Human HNRNPL Protein (89-335 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 89-335 aa
• Description: Splicing factor binding to exonic or intronic sites and acting as either an activator or repressor of exon inclusion. Exhibits a binding preference for CA-rich elents. Component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes and associated with most nascent transcripts. Associates, together with APEX1, to the negative calcium responsive elent (nCaRE) B2 of the APEX2 promoter.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 43.1 kDa
• AA Sequence: GENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: HNRNPL heterogeneous nuclear ribonucleoprotein L [ Homo sapiens ]
• Official Symbol: HNRNPL
• Synonyms: HNRNPL; HNRPL; hnRNP L; hnRNP-L; P/OKcl.14; FLJ35509
• Gene ID: 3191
• mRNA Refseq: NM_001005335
• Protein Refseq: NP_001005335
• MIM: 603083
• UniProt ID: P14866