Recombinant Human HNRNPD Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : HNRNPD-5765H
Product Overview : HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_112738) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It localizes to both the nucleus and the cytoplasm. This protein is implicated in the regulation of mRNA stability. Alternative splicing of this gene results in four transcript variants.
Molecular Mass : 38.3 kDa
AA Sequence : MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HNRNPD heterogeneous nuclear ribonucleoprotein D [ Homo sapiens (human) ]
Official Symbol HNRNPD
Synonyms HNRNPD; heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa); AUF1, heterogeneous nuclear ribonucleoprotein D (AU rich element RNA binding protein 1, 37kD), HNRPD; heterogeneous nuclear ribonucleoprotein D0; hnRNP D0; ARE-binding protein AUFI, type A; P37; AUF1; AUF1A; HNRPD; hnRNPD0;
Gene ID 3184
mRNA Refseq NM_031370
Protein Refseq NP_112738
MIM 601324
UniProt ID Q14103

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HNRNPD Products

Required fields are marked with *

My Review for All HNRNPD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon