Recombinant Human HNRNPAB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HNRNPAB-2284H
• Product Overview: HNRNPAB MS Standard C13 and N15-labeled recombinant protein (NP_112556) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes. They are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene, which binds to one of the components of the multiprotein editosome complex, has two repeats of quasi-RRM (RNA recognition motif) domains that bind to RNAs. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Molecular Mass: 35.8 kDa
• AA Sequence: MSEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HNRNPAB heterogeneous nuclear ribonucleoprotein A/B [ Homo sapiens (human) ]
• Official Symbol: HNRNPAB
• Synonyms: HNRNPAB; heterogeneous nuclear ribonucleoprotein A/B; ABBP1; HNRPAB; heterogeneous nuclear ribonucleoprotein A/B; ABBP-1; APOBEC1-binding protein 1; apobec-1 binding protein 1; apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1-binding protein 1; hnRNP A/B; hnRNP type A/B protein
• Gene ID: 3182
• mRNA Refseq: NM_031266
• Protein Refseq: NP_112556
• MIM: 602688
• UniProt ID: Q99729