Recombinant Human HNMT Protein, GST-tagged

Cat.No. : HNMT-4898H
Product Overview : Human HNMT full-length ORF ( AAH05907, 1 a.a. - 51 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq
Molecular Mass : 31.35 kDa
AA Sequence : MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRYQNCC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HNMT histamine N-methyltransferase [ Homo sapiens ]
Official Symbol HNMT
Synonyms HNMT; histamine N-methyltransferase; HMT; HNMT-S1; HNMT-S2;
Gene ID 3176
mRNA Refseq NM_001024074
Protein Refseq NP_001019245
MIM 605238
UniProt ID P50135

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HNMT Products

Required fields are marked with *

My Review for All HNMT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon