Recombinant Human HNMT Protein, GST-tagged

• Cat.No.: HNMT-4898H
• Product Overview: Human HNMT full-length ORF ( AAH05907, 1 a.a. - 51 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 31.35 kDa
• AA Sequence: MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRYQNCC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HNMT histamine N-methyltransferase [ Homo sapiens ]
• Official Symbol: HNMT
• Synonyms: HNMT; histamine N-methyltransferase; HMT; HNMT-S1; HNMT-S2
• Gene ID: 3176
• mRNA Refseq: NM_001024074
• Protein Refseq: NP_001019245
• MIM: 605238
• UniProt ID: P50135