Recombinant Human HNMT

• Cat.No.: HNMT-27547TH
• Product Overview: Recombinant full length Human HNMT, expressed in Saccharomyces cerevisiae; amino acids 1-292, 292 amino acids, MWt 33.3 kDa. Protein is tagged with 26 kDa proprietary tag.

Specification

• Description: In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKL PGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQY PGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWH KETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPAT LKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQ DDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCF IDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
• Tag: Non
• Protein length: 1-292 a.a.
• Full Length: Full L.

Gene Information

• Gene Name: HNMT histamine N-methyltransferase [ Homo sapiens ]
• Official Symbol: HNMT
• Synonyms: HNMT; histamine N-methyltransferase
• Gene ID: 3176
• mRNA Refseq: NM_001024074
• Protein Refseq: NP_001019245
• MIM: 605238
• Uniprot ID: P50135
• Chromosome Location: 2q22.1
• Pathway: Histidine metabolism, organism-specific biosystem; Histidine metabolism, conserved biosystem; histamine degradation, conserved biosystem
• Function: histamine N-methyltransferase activity; methyltransferase activity; transferase activity