Recombinant Human HNMT protein(1-292 aa), His-tagged
Cat.No. : | HNMT-13863H |
Product Overview : | Recombinant Human HNMT protein(1-292 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | March 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-292 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGDENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA |
Gene Name | HNMT histamine N-methyltransferase [ Homo sapiens ] |
Official Symbol | HNMT |
Synonyms | HNMT; histamine N-methyltransferase; HMT; HNMT-S1; HNMT-S2; |
Gene ID | 3176 |
mRNA Refseq | NM_001024074 |
Protein Refseq | NP_001019245 |
MIM | 605238 |
UniProt ID | P50135 |
◆ Recombinant Proteins | ||
HNMT-1704H | Recombinant Human Histamine N-Methyltransferase, His-tagged | +Inquiry |
HNMT-2533R | Recombinant Rat HNMT Protein, His (Fc)-Avi-tagged | +Inquiry |
Hnmt-4643M | Recombinant Mouse Hnmt protein, His&Myc-tagged | +Inquiry |
HNMT-5216C | Recombinant Chicken HNMT | +Inquiry |
HNMT-22H | Active Recombinant Human HNMT protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HNMT-1355R | Active Native Rat HNMT Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNMT-5455HCL | Recombinant Human HNMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HNMT Products
Required fields are marked with *
My Review for All HNMT Products
Required fields are marked with *
0
Inquiry Basket