Recombinant Human HNF1A Protein, GST-tagged

• Cat.No.: HNF1A-4891H
• Product Overview: Human HNF1A partial ORF (P20823, 532 a.a. - 631 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 532-631 a.a.
• Description: The protein encoded by this gene is a transcription factor required for the expression of several liver-specific genes. The encoded protein functions as a homodimer and binds to the inverted palindrome 5-GTTAATNATTAAC-3. Defects in this gene are a cause of maturity onset diabetes of the young type 3 (MODY3) and also can result in the appearance of hepatic adenomas. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: ALASLTPTKQVFTSDTEASSESGLHTPASQATTLHVPSQDPAGIQHLQPAHRLSASPTVSSSSLVLYQSSDSSNGQSHLLPSNHSVIETFISTQMASSSQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HNF1A HNF1 homeobox A [ Homo sapiens ]
• Official Symbol: HNF1A
• Synonyms: HNF1A; HNF1 homeobox A; MODY3, TCF1, transcription factor 1, hepatic; LF B1, hepatic nuclear factor (HNF1), albumin proximal factor; hepatocyte nuclear factor 1-alpha; HNF1; LFB1; HNF-1-alpha; albumin proximal factor; hepatic nuclear factor 1; transcription factor 1, hepatic; interferon production regulator factor; liver-specific transcription factor LF-B1; TCF1; MODY3; TCF-1; HNF-1A; IDDM20
• Gene ID: 6927
• mRNA Refseq: NM_000545
• Protein Refseq: NP_000536
• MIM: 142410
• UniProt ID: P20823