Recombinant Human HMGCS1 Protein, GST-tagged

• Cat.No.: HMGCS1-4876H
• Product Overview: Human HMGCS1 partial ORF ( NP_002121, 422 a.a. - 520 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HMGCS1 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 1) is a Protein Coding gene. Among its related pathways are Bisphosphonate Pathway, Pharmacodynamics and Sterol Regulatory Element-Binding Proteins (SREBP) signalling. GO annotations related to this gene include protein homodimerization activity and isomerase activity. An important paralog of this gene is HMGCS2.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: VFAENMKLREDTHHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTYARRPTPNDDTLDEGVGLVHSNIATEHIPSPAKKVPRLPATAAEPEAAVISNGEH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HMGCS1 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble) [ Homo sapiens ]
• Official Symbol: HMGCS1
• Synonyms: HMGCS1; 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble); 3 hydroxy 3 methylglutaryl Coenzyme A synthase 1 (soluble) , HMGCS; hydroxymethylglutaryl-CoA synthase, cytoplasmic; 3 hydroxy 3 methylglutaryl coenzyme A (HMG CoA) synthase; HMG-CoA synthase; 3-hydroxy-3-methylglutaryl coenzyme A synthase; 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) synthase; 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble); HMGCS; MGC90332
• Gene ID: 3157
• mRNA Refseq: NM_001098272
• Protein Refseq: NP_001091742
• MIM: 142940
• UniProt ID: Q01581