Recombinant Human HMGCS1

• Cat.No.: HMGCS1-29335TH
• Product Overview: Recombinant fragment of Human HMGCS1 with N terminal proprietary tag, 36.52kDa.

Specification

• Protein length: 99 amino acids
• Molecular Weight: 36.520kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VFAENMKLREDTYHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTYARRPTPNDDTLDEGVGLVHSNIATEHIPSPAKKVPRLPATAAEPEAAVISNGEH
• Sequence Similarities: Belongs to the HMG-CoA synthase family.
• Tag: Non

Gene Information

• Gene Name: HMGCS1 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble) [ Homo sapiens ]
• Official Symbol: HMGCS1
• Synonyms: HMGCS1; 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble); 3 hydroxy 3 methylglutaryl Coenzyme A synthase 1 (soluble) , HMGCS; hydroxymethylglutaryl-CoA synthase, cytoplasmic; 3 hydroxy 3 methylglutaryl coenzyme A (HMG CoA) synthase
• Gene ID: 3157
• mRNA Refseq: NM_001098272
• Protein Refseq: NP_001091742
• MIM: 142940
• Uniprot ID: Q01581
• Chromosome Location: 5p14-p13
• Pathway: Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, organism-specific biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, conserved biosystem; Cholesterol Biosynthesis, organism-specific biosystem
• Function: catalytic activity; drug binding; hydroxymethylglutaryl-CoA synthase activity; isomerase activity; organic acid binding