Recombinant Human HMGCS1
Cat.No. : | HMGCS1-29335TH |
Product Overview : | Recombinant fragment of Human HMGCS1 with N terminal proprietary tag, 36.52kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Molecular Weight : | 36.520kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VFAENMKLREDTYHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTYARRPTPNDDTLDEGVGLVHSNIATEHIPSPAKKVPRLPATAAEPEAAVISNGEH |
Sequence Similarities : | Belongs to the HMG-CoA synthase family. |
Gene Name | HMGCS1 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble) [ Homo sapiens ] |
Official Symbol | HMGCS1 |
Synonyms | HMGCS1; 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble); 3 hydroxy 3 methylglutaryl Coenzyme A synthase 1 (soluble) , HMGCS; hydroxymethylglutaryl-CoA synthase, cytoplasmic; 3 hydroxy 3 methylglutaryl coenzyme A (HMG CoA) synthase; |
Gene ID | 3157 |
mRNA Refseq | NM_001098272 |
Protein Refseq | NP_001091742 |
MIM | 142940 |
Uniprot ID | Q01581 |
Chromosome Location | 5p14-p13 |
Pathway | Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, organism-specific biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, conserved biosystem; Cholesterol Biosynthesis, organism-specific biosystem; |
Function | catalytic activity; drug binding; hydroxymethylglutaryl-CoA synthase activity; isomerase activity; organic acid binding; |
◆ Recombinant Proteins | ||
HMGCS1-2524R | Recombinant Rat HMGCS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HMGCS1-1691M | Recombinant Mouse HMGCS1 Protein (1-520 aa), His-tagged | +Inquiry |
HMGCS1-2869R | Recombinant Rat HMGCS1 Protein | +Inquiry |
HMGCS1-6962C | Recombinant Chicken HMGCS1 | +Inquiry |
HMGCS1-59H | Recombinant Human HMGCS1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGCS1-803HCL | Recombinant Human HMGCS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMGCS1 Products
Required fields are marked with *
My Review for All HMGCS1 Products
Required fields are marked with *
0
Inquiry Basket