Recombinant Human HMGB4 Protein, GST-tagged

Cat.No. : HMGB4-4873H
Product Overview : Human HMGB4 full-length ORF (1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HMGB4 (High Mobility Group Box 4) is a Protein Coding gene. GO annotations related to this gene include chromatin binding. An important paralog of this gene is HMGB2.
Molecular Mass : 48.9 kDa
AA Sequence : MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPNTYVGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKARYQEEMMNYVGKRKKRRKRDPQEPRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRGKRVRQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HMGB4 high mobility group box 4 [ Homo sapiens ]
Official Symbol HMGB4
Synonyms HMGB4; high mobility group box 4; high mobility group protein B4; FLJ40388; HMG2 like; dJ1007G16.5; MGC88128;
Gene ID 127540
mRNA Refseq NM_145205
Protein Refseq NP_660206
UniProt ID Q8WW32

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HMGB4 Products

Required fields are marked with *

My Review for All HMGB4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon