Recombinant Human HMGB4, His-tagged
Cat.No. : | HMGB4-106H |
Product Overview : | Recombinant Human High Mobility Group Protein B4/HMGB4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Ser186) of Human HMGB4 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-186 a.a. |
Description : | High Mobility Group Protein B4 (HMGB4) is a member of the HMGB family. HMGB4 localizes to the nucleus and contains two HMG box DNA-binding domains. HMGB4 associates with chromatin. In contrast to HMGB1, HMGB4 acts as a potent transcriptional repressor. During spermatogenesis, HMGB4 is present in the euchromatin of late pachytene spermatocytes and haploid round spermatids, whereas stronger expression is observed during the elongation phase, where it localizes to the basal pole of the nucleus in a manner mutually exclusive with H1FNT (H1T2) localized at the apical pole. |
AA Sequence : | MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPSTYVGFKEFSRKCSEKWRSISKHEKAKYEALAK LDKARYQEEMMNYVGKRKKRRKRDPQAPRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKM WSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRGKRVRQSVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | HMGB4 high mobility group box 4 [ Homo sapiens ] |
Official Symbol | HMGB4 |
Synonyms | HMGB4; high mobility group box 4; high mobility group protein B4; FLJ40388; HMG2 like; dJ1007G16.5; MGC88128; |
Gene ID | 127540 |
mRNA Refseq | NM_145205 |
Protein Refseq | NP_660206 |
UniProt ID | Q8WW32 |
Chromosome Location | 1p35.1 |
Function | DNA binding; |
◆ Recombinant Proteins | ||
HMGB4-3673H | Recombinant Human HMGB4 Protein (Asn25-Arg167), N-His tagged | +Inquiry |
HMGB4-106H | Recombinant Human HMGB4, His-tagged | +Inquiry |
Hmgb4-1628R | Recombinant Rat Hmgb4 Protein, His-tagged | +Inquiry |
HMGB4-3646HF | Recombinant Full Length Human HMGB4 Protein, GST-tagged | +Inquiry |
HMGB4-13844H | Recombinant Human HMGB4, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB4-5476HCL | Recombinant Human HMGB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMGB4 Products
Required fields are marked with *
My Review for All HMGB4 Products
Required fields are marked with *
0
Inquiry Basket