Recombinant Human HMGB3 protein, GST-tagged

• Cat.No.: HMGB3-301335H
• Product Overview: Recombinant Human HMGB3 protein(1-103 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-103 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLF
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: HMGB3
• Synonyms: HMGB3; high mobility group box 3; high mobility group (nonhistone chromosomal) protein 4 , high mobility group box 3 , HMG4; high mobility group protein B3; HMG2A; MGC90319; non histone chromosomal protein; high-mobility group box 3; high mobility group protein 4; high mobility group protein 2a; non-histone chromosomal protein; high-mobility group (nonhistone chromosomal) protein 4; HMG4; HMG-4; HMG-2a
• Gene ID: 3149
• mRNA Refseq: NM_005342
• Protein Refseq: NP_005333
• MIM: 300193
• UniProt ID: O15347