Recombinant Human HMGB2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HMGB2-3390H
• Product Overview: HMGB2 MS Standard C13 and N15-labeled recombinant protein (NP_002120) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.
• Molecular Mass: 24 kDa
• AA Sequence: MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HMGB2 high mobility group box 2 [ Homo sapiens (human) ]
• Official Symbol: HMGB2
• Synonyms: HMGB2; high mobility group box 2; high mobility group (nonhistone chromosomal) protein 2, high mobility group box 2, HMG2; high mobility group protein B2; HMG-2; high-mobility group box 2; high mobility group protein 2; high-mobility group (nonhistone chromosomal) protein 2; HMG2
• Gene ID: 3148
• mRNA Refseq: NM_002129
• Protein Refseq: NP_002120
• MIM: 163906
• UniProt ID: P26583