Recombinant Human HMGB2 Protein, GST-tagged
Cat.No. : | HMGB2-4869H |
Product Overview : | Human HMGB2 full-length ORF ( AAH00903.2, 1 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. [provided by RefSeq |
Molecular Mass : | 47.19 kDa |
AA Sequence : | MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HMGB2 high mobility group box 2 [ Homo sapiens ] |
Official Symbol | HMGB2 |
Synonyms | HMGB2; high mobility group box 2; high mobility group (nonhistone chromosomal) protein 2 , high mobility group box 2 , HMG2; high mobility group protein B2; HMG-2; high-mobility group box 2; high mobility group protein 2; high-mobility group (nonhistone chromosomal) protein 2; HMG2; |
Gene ID | 3148 |
mRNA Refseq | NM_001130688 |
Protein Refseq | NP_001124160 |
MIM | 163906 |
UniProt ID | P26583 |
◆ Recombinant Proteins | ||
HMGB2-4237M | Recombinant Mouse HMGB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Hmgb2-3412M | Recombinant Mouse Hmgb2 Protein, Myc/DDK-tagged | +Inquiry |
HMGB2-2002HFL | Recombinant Full Length Human HMGB2 Protein, C-Flag-tagged | +Inquiry |
HMGB2-7729M | Recombinant Mouse HMGB2 Protein | +Inquiry |
HMGB2-1080H | Recombinant Human HMGB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB2-5477HCL | Recombinant Human HMGB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMGB2 Products
Required fields are marked with *
My Review for All HMGB2 Products
Required fields are marked with *
0
Inquiry Basket