Recombinant Human HMGB2 Protein, His-tagged
Cat.No. : | HMGB2-712H |
Product Overview : | Recombinant Human HMGB2, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
Molecular Mass : | 25.07kD |
AA Sequence : | MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEEVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | HMGB2 high mobility group box 2 [ Homo sapiens ] |
Official Symbol | HMGB2 |
Synonyms | HMGB2; high mobility group box 2; high mobility group (nonhistone chromosomal) protein 2 , high mobility group box 2 , HMG2; high mobility group protein B2; HMG-2; high-mobility group box 2; high mobility group protein 2; high-mobility group (nonhistone chromosomal) protein 2; HMG2; |
Gene ID | 3148 |
mRNA Refseq | NM_001130688 |
Protein Refseq | NP_001124160 |
MIM | 163906 |
UniProt ID | P26583 |
◆ Recombinant Proteins | ||
HMGB2-147H | Recombinant Human HMGB2 Protein (Met1-Glu209), C-His tagged, Animal-free, Carrier-free | +Inquiry |
HMGB2-2703H | Recombinant Human HMGB2 protein(101-190 aa), C-His-tagged | +Inquiry |
HMGB2-148H | Recombinant Human HMGB2 Protein (Met1-Pro187), N-His-SUMO tagged, Animal-free, Carrier-free | +Inquiry |
HMGB2-711H | Recombinant Human HMGB2 Protein, His-tagged | +Inquiry |
HMGB2-13842H | Recombinant Human HMGB2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB2-5477HCL | Recombinant Human HMGB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMGB2 Products
Required fields are marked with *
My Review for All HMGB2 Products
Required fields are marked with *
0
Inquiry Basket