Recombinant Human HMGA2 Protein, GST-tagged

• Cat.No.: HMGA2-4865H
• Product Overview: Human HMGA2 partial ORF ( NP_003474, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.86 kDa
• AA Sequence: MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HMGA2 high mobility group AT-hook 2 [ Homo sapiens ]
• Official Symbol: HMGA2
• Synonyms: HMGA2; high mobility group AT-hook 2; high mobility group (nonhistone chromosomal) protein isoform I C , HMGIC; high mobility group protein HMGI-C; BABL; LIPO; High-mobility group protein HMGI-C; high mobility group AT-hook protein 2; high-mobility group (nonhistone chromosomal) protein isoform I-C; HMGIC; HMGI-C; STQTL9
• Gene ID: 8091
• mRNA Refseq: NM_003483
• Protein Refseq: NP_003474
• MIM: 600698
• UniProt ID: P52926