Recombinant Human HLA-V Protein, GST-tagged

Cat.No. : HLA-V-4771H
Product Overview : Human LOC554223 full-length ORF ( AAH51362.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HLA-V (Major Histocompatibility Complex, Class I, V (Pseudogene)) is a Pseudogene.
Molecular Mass : 47.3 kDa
AA Sequence : MDWGGPALGIPHLCRVSLLPLPTCVGSFFLGTHRAAPVLTPIECRVSREANQCSRGPGSKVPTHPPGLRFFPVAEDGVMAPRTLLLLLSGALVLTQTWAGFHSLRYFHTTMSRPGRADPRFLSVGDVDDTQCVRLDSDATSPRMEPRAPWMEQEGPEYWEEETGTAKAKAQFYRVNLRTLSGYYNQSEA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HLA-V major histocompatibility complex, class I, V (pseudogene) [ Homo sapiens (human) ]
Official Symbol HLA-V
Synonyms HLA-V; major histocompatibility complex, class I, V (pseudogene); HLA-75; dJ377H14.4; FLJ17298; FLJ46428; MGC59962; HLA-75 pseudogene; histocompatibility antigen-related
Gene ID 352962

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HLA-V Products

Required fields are marked with *

My Review for All HLA-V Products

Required fields are marked with *

0

Inquiry Basket

cartIcon