Recombinant Full Length Human CHP Protein, GST-tagged

• Cat.No.: CHP-3214HF
• Product Overview: Human CHP full-length ORF (AAH08373, 1 a.a. - 66 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 66 amino acids
• Description: This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. [provided by RefSeq, Jul 2008]
• Molecular Mass: 33 kDa
• AA Sequence: MESHSVTQAGVQWRDLGSLQPLPPGFKQFSHLSLPSSWDYRRVPPYLGNFCIFSGEGVSPCWPGWS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHP calcium binding protein P22 [ Homo sapiens ]
• Official Symbol: CHP
• Synonyms: CHP; calcium binding protein P22; calcium-binding protein p22; calcineurin B homolog; SLC9A1 binding protein; calcium-binding protein CHP; calcineurin homologous protein; SLC9A1BP; FLJ20350
• Gene ID: 11261
• mRNA Refseq: NM_007236
• Protein Refseq: NP_009167
• MIM: 606988