Recombinant Human HLA-DRB4 protein, GST-tagged

• Cat.No.: HLA-DRB4-3738H
• Product Overview: Recombinant Human HLA-DRB4 protein(1-266 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 1-266 aa
• AA Sequence: MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: HLA-DRB4 major histocompatibility complex, class II, DR beta 4 [ Homo sapiens ]
• Official Symbol: HLA-DRB4
• Synonyms: HLA-DRB4; major histocompatibility complex, class II, DR beta 4; HLA DR4B; DR4; DR-4; leukocyte antigen; MHC class2 antigen; MHC HLA DR-beta chain; MHC class II antigen DRB4; DRB1 transplantation antigen; human leucocyte antigen DRB4; MHC class II antigen HLA-DR-beta; HLA class II histocompatibility antigen, DR beta 4 chain; DRB4; HLA-DR4B
• Gene ID: 3126
• mRNA Refseq: NM_021983
• Protein Refseq: NP_068818
• UniProt ID: P13762