Recombinant Human HLA-DRB1 Protein, His-SUMO/MYC-tagged
Cat.No. : | HLA-DRB1-1240H |
Product Overview : | Recombinant Human HLA-DRB1 Protein (30-227aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
ProteinLength : | 30-227 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 42.9 kDa |
AA Sequence : | GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQ RRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKA GVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | HLA-DRB1 major histocompatibility complex, class II, DR beta 1 [ Homo sapiens ] |
Official Symbol | HLA-DRB1 major histocompatibility complex, class II, DR beta 1 [ Homo sapiens ] |
Synonyms | HLA-DRB1; major histocompatibility complex, class II, DR beta 1; HLA DR1B; DW2.2/DR2.2; MHC class II antigen; lymphocyte antigen DRB1; MHC class II HLA-DRw10-beta; human leucocyte antigen DRB1; MHC class II HLA-DR beta 1 chain; MHC class II HLA-DR-beta cell surface glycoprotein; HLA class II histocompatibility antigen, DR-1 beta chain; SS1; DRB1; DRw10; HLA-DRB; HLA-DR1B; FLJ75017; FLJ76359 |
Gene ID | 3123 |
mRNA Refseq | NM_001243965 |
Protein Refseq | NP_001230894 |
MIM | 142857 |
UniProt ID | P01911 |
◆ Recombinant Proteins | ||
LY6K-9378M | Recombinant Mouse LY6K Protein | +Inquiry |
PTGS2-01H | Active Recombinant Human PTGS2 2N580A Mutant Protein, His-tagged | +Inquiry |
Ccdc24-2001M | Recombinant Mouse Ccdc24 Protein, Myc/DDK-tagged | +Inquiry |
IL1B-364H | Active Recombinant Human IL1B Protein | +Inquiry |
MAP3K12-2667R | Recombinant Rhesus monkey MAP3K12 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
AMBP-5312H | Native Human Alpha-1-Microglobulin/Bikunin Precursor | +Inquiry |
KLK3-8247H | Native Human Prostate Specific Antigen | +Inquiry |
PRSS7-42P | Native Porcine Enterokinase | +Inquiry |
MMP1-45H | Native Human MMP-1 | +Inquiry |
Lectin-1800L | Active Native Lycopersicon Esculentum Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA13-847MCL | Recombinant Mouse IFNA13 cell lysate | +Inquiry |
ANKRD7-82HCL | Recombinant Human ANKRD7 cell lysate | +Inquiry |
OPTN-001HCL | Recombinant Human OPTN cell lysate | +Inquiry |
MBD3L1-4444HCL | Recombinant Human MBD3L1 293 Cell Lysate | +Inquiry |
GRB7-5754HCL | Recombinant Human GRB7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLA-DRB1 Products
Required fields are marked with *
My Review for All HLA-DRB1 Products
Required fields are marked with *
0
Inquiry Basket