Recombinant Human HLA-C Protein, GST-tagged

• Cat.No.: HLA-C-4834H
• Product Overview: Human HLA-C full-length ORF (1 a.a. - 336 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HLA-C belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Over one hundred HLA-C alleles have been described [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 63.8 kDa
• AA Sequence: MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAAQITQRKLEASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWAPGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQGPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCKA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Protein length: 1-336 a.a.

Gene Information

• Gene Name: HLA-C major histocompatibility complex, class I, C [ Homo sapiens ]
• Official Symbol: HLA-C
• Synonyms: major histocompatibility complex, class I, C; 4933; Ensembl:ENSG00000204525; FLJ27082; HLA class I histocompatibility antigen, Cw-1 alpha chain;MHC class I antigen heavy chain HLA-C;human leukocyte antigen-C alpha chain;major histocompatibility antigen HLA-C;HLA class I histocompatibility antigen, C alpha chain; HLC-C; D6S204; PSORS1; HLA-JY3
• Gene ID: 3107
• mRNA Refseq: NM_001243042
• Protein Refseq: NP_001229971
• MIM: 142840
• UniProt ID: O19617