Recombinant Human HKDC1 Protein, GST-tagged

• Cat.No.: HKDC1-4828H
• Product Overview: Human HKDC1 partial ORF ( NP_079406, 102 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the hexokinase protein family. The encoded protein is involved in glucose metabolism, and reduced expression may be associated with gestational diabetes mellitus. High expression of this gene may also be associated with poor prognosis in hepatocarcinoma. [provided by RefSeq, Sep 2016]
• Molecular Mass: 36.63 kDa
• AA Sequence: KRHVQMESQFYPTPNEIIRGNGIELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGVQDTDVVSRLTKAMRRHKDMD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HKDC1 hexokinase domain containing 1 [ Homo sapiens ]
• Official Symbol: HKDC1
• Synonyms: HKDC1; hexokinase domain containing 1; FLJ22761; FLJ37767
• Gene ID: 80201
• UniProt ID: Q2TB90