Recombinant Human HK3 Protein, His-tagged
Cat.No. : | HK3-155H |
Product Overview : | Recombinant Human HK3 fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 3. Similar to hexokinases 1 and 2, this allosteric enzyme is inhibited by its product glucose-6-phosphate. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 100kD |
AA Sequence : | MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQALRGQASPAPAVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHRVEPRSQEFVIPQEVMLGAGQQLFDFAAHCLSEFLDAQPVNKQGLQLGFSFSFPCHQTGLDRSTLISWTKGFRCSGVEGQDVVQLLRDAIRRQGAYNIDVVAVVNDTVGTMMGCEPGVRPCEVGLVVDTGTNACYMEEA |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | HK3 hexokinase 3 (white cell) [ Homo sapiens ] |
Official Symbol | HK3 |
Synonyms | HK3; hexokinase 3 (white cell); hexokinase-3; HK III; hexokinase type III; ATP:D-hexose 6-phosphotransferase; HXK3; HKIII; |
Gene ID | 3101 |
mRNA Refseq | NM_002115 |
Protein Refseq | NP_002106 |
MIM | 142570 |
UniProt ID | P52790 |
◆ Recombinant Proteins | ||
HK3-2518R | Recombinant Rat HK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HK3-42H | Recombinant Human Hexokinase 3,His-tagged | +Inquiry |
HK3-1143H | Recombinant Human Hexokinase 3, His-tagged | +Inquiry |
HK3-2863R | Recombinant Rat HK3 Protein | +Inquiry |
HK3-7714M | Recombinant Mouse HK3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HK3-550HCL | Recombinant Human HK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HK3 Products
Required fields are marked with *
My Review for All HK3 Products
Required fields are marked with *
0
Inquiry Basket