Recombinant Human HIST3H2BB Protein, GST-tagged

• Cat.No.: HIST3H2BB-4817H
• Product Overview: Human HIST3H2BB full-length ORF (BAC03613.1, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H2B family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq
• Molecular Mass: 40.3 kDa
• AA Sequence: MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HIST3H2BB histone cluster 3 H2B family member b [ Homo sapiens (human) ]
• Official Symbol: HIST3H2BB
• Synonyms: HIST3H2BB; histone cluster 3 H2B family member b; H2Bb; histone H2B type 3-B; H2B type 12; histone 3, H2bb; histone cluster 3, H2bb
• Gene ID: 128312
• mRNA Refseq: NM_175055
• Protein Refseq: NP_778225
• MIM: 615046
• UniProt ID: Q8N257