Recombinant Human HIST2H4A Protein, GST-tagged
Cat.No. : | HIST2H4A-4814H |
Product Overview : | Human HIST2H4 partial ORF ( NP_003539, 31 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy. [provided by RefSeq |
Molecular Mass : | 33.77 kDa |
AA Sequence : | TKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HIST2H4A histone cluster 2, H4a [ Homo sapiens ] |
Official Symbol | HIST2H4A |
Synonyms | HIST2H4A; histone cluster 2, H4a; H4 histone, family 2 , H4/n, H4F2, H4FN, HIST2H4, histone 2, H4 , histone 2, H4a; histone H4; histone 2, H4a; H4 histone, family 2; histone IV, family 2; H4 histone family, member N; H4; H4/n; H4F2; H4FN; FO108; HIST2H4; HIST4H4; HIST1H4A; HIST1H4B; HIST1H4C; HIST1H4D; HIST1H4E; HIST1H4F; HIST1H4H; HIST1H4I; HIST1H4J; HIST1H4K; HIST1H4L; HIST2H4B; |
Gene ID | 8370 |
mRNA Refseq | NM_003548 |
Protein Refseq | NP_003539 |
MIM | 142750 |
UniProt ID | P62805 |
◆ Recombinant Proteins | ||
HIST2H4A-303H | Recombinant Human Full Length HIST2H4A protein(Met1-Gly103) | +Inquiry |
HIST2H4A-129H | Recombinant Human HIST2H4A Protein, HIS-tagged | +Inquiry |
HIST2H4A-4814H | Recombinant Human HIST2H4A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST2H4A-5514HCL | Recombinant Human HIST2H4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIST2H4A Products
Required fields are marked with *
My Review for All HIST2H4A Products
Required fields are marked with *
0
Inquiry Basket