Recombinant Human HIST2H4A Protein, GST-tagged

• Cat.No.: HIST2H4A-4814H
• Product Overview: Human HIST2H4 partial ORF ( NP_003539, 31 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 33.77 kDa
• AA Sequence: TKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HIST2H4A histone cluster 2, H4a [ Homo sapiens ]
• Official Symbol: HIST2H4A
• Synonyms: HIST2H4A; histone cluster 2, H4a; H4 histone, family 2 , H4/n, H4F2, H4FN, HIST2H4, histone 2, H4 , histone 2, H4a; histone H4; histone 2, H4a; H4 histone, family 2; histone IV, family 2; H4 histone family, member N; H4; H4/n; H4F2; H4FN; FO108; HIST2H4; HIST4H4; HIST1H4A; HIST1H4B; HIST1H4C; HIST1H4D; HIST1H4E; HIST1H4F; HIST1H4H; HIST1H4I; HIST1H4J; HIST1H4K; HIST1H4L; HIST2H4B
• Gene ID: 8370
• mRNA Refseq: NM_003548
• Protein Refseq: NP_003539
• MIM: 142750
• UniProt ID: P62805