Recombinant Human HIST2H2BE Protein, GST-tagged

• Cat.No.: HIST2H2BE-4810H
• Product Overview: Human HIST2H2BE full-length ORF ( NP_003519.1, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2B family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 40.3 kDa
• AA Sequence: MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HIST2H2BE histone cluster 2, H2be [ Homo sapiens ]
• Official Symbol: HIST2H2BE
• Synonyms: HIST2H2BE; histone cluster 2, H2be; histone H2B type 2-E; histone H2B.q; histone 2, H2be; histone H2B-GL105; H2B histone family, member Q; H2B; H2BQ; GL105; H2B.1; H2BFQ; H2BGL105; MGC119802; MGC119804; MGC129733; MGC129734
• Gene ID: 8349
• mRNA Refseq: NM_003528
• Protein Refseq: NP_003519