Recombinant Human HIST1H4I Protein, GST-tagged
Cat.No. : | HIST1H4I-4804H |
Product Overview : | Human HIST1H4I full-length ORF ( AAH16336, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the histone microcluster on chromosome 6p21.33. [provided by RefSeq |
Molecular Mass : | 37.07 kDa |
AA Sequence : | MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGPIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HIST1H4I histone cluster 1 H4 family member i [ Homo sapiens (human) ] |
Official Symbol | HIST1H4I |
Synonyms | HIST1H4I; histone cluster 1 H4 family member i; H4M; H4/m; H4FM; histone H4; H4 histone family, member M; Histone 4 family, member M; histone 1, H4i; histone cluster 1, H4i; histone family member |
Gene ID | 8294 |
mRNA Refseq | NM_003495 |
Protein Refseq | NP_003486 |
MIM | 602833 |
UniProt ID | P62805 |
◆ Recombinant Proteins | ||
HIST1H4I-4213M | Recombinant Mouse HIST1H4I Protein, His (Fc)-Avi-tagged | +Inquiry |
HIST1H4I-4804H | Recombinant Human HIST1H4I Protein, GST-tagged | +Inquiry |
HIST1H4I-7691M | Recombinant Mouse HIST1H4I Protein | +Inquiry |
HIST1H4I-3593HF | Recombinant Full Length Human HIST1H4I Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST1H4I-5521HCL | Recombinant Human HIST1H4I 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIST1H4I Products
Required fields are marked with *
My Review for All HIST1H4I Products
Required fields are marked with *
0
Inquiry Basket