Recombinant Human HIST1H3A protein, His-tagged

• Cat.No.: HIST1H3A-3032H
• Product Overview: Recombinant Human HIST1H3A protein(P68431)(2-135aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 2-135aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 19.3 kDa
• AA Sequence: ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: HIST1H3A histone cluster 1, H3a [ Homo sapiens ]
• Official Symbol: HIST1H3A
• Synonyms: HIST1H3A; histone cluster 1, H3a; H3 histone family, member A , H3FA, histone 1, H3a; histone H3.1; H3/A; histone H3/a; histone H3/b; histone H3/c; histone H3/d; histone H3/f; histone H3/h; histone H3/i; histone H3/j; histone H3/k; histone H3/l; histone 1, H3a; H3 histone family, member A; H3FA
• Gene ID: 8350
• mRNA Refseq: NM_003529
• Protein Refseq: NP_003520
• MIM: 602810
• UniProt ID: P68431