Recombinant Human HIST1H2BC Protein (2-125 aa), GST-tagged

Cat.No. : HIST1H2BC-1184H
Product Overview : Recombinant Human HIST1H2BC Protein (2-125 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 2-125 aa
Description : Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a tplate. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome rodeling.Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 40.6 kDa
AA Sequence : PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name HIST1H2BC histone cluster 1 H2B family member c [ Homo sapiens (human) ]
Official Symbol HIST1H2BC
Synonyms H2B.1; H2B/l; H2BFL; dJ221C16.3;
Gene ID 8347
mRNA Refseq NM_003526
Protein Refseq NP_003517
UniProt ID P62807

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HIST1H2BC Products

Required fields are marked with *

My Review for All HIST1H2BC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon