Recombinant Human HIST1H2BB Protein (2-126 aa), His-SUMO-tagged

• Cat.No.: HIST1H2BB-553H
• Product Overview: Recombinant Human HIST1H2BB Protein (2-126 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Mature Protein.

Specification

• Description: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a tplate. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome rodeling.
• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 29.8 kDa
• Protein length: 2-126 aa
• AA Sequence: PEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: HIST1H2BB histone cluster 1, H2bb [ Homo sapiens ]
• Official Symbol: HIST1H2BB
• Synonyms: HIST1H2BB; H2B/f; histone H2B.1; H2B.1; H2BFF; MGC119804
• Gene ID: 3018
• mRNA Refseq: NM_021062
• Protein Refseq: NP_066406
• MIM: 602803
• UniProt ID: P33778