Recombinant Human HIST1H2BB Protein (2-126 aa), His-SUMO-tagged
Cat.No. : | HIST1H2BB-553H |
Product Overview : | Recombinant Human HIST1H2BB Protein (2-126 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-126 aa |
Description : | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a tplate. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome rodeling. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 29.8 kDa |
AA Sequence : | PEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | HIST1H2BB histone cluster 1, H2bb [ Homo sapiens ] |
Official Symbol | HIST1H2BB |
Synonyms | HIST1H2BB; H2B/f; histone H2B.1; H2B.1; H2BFF; MGC119804; |
Gene ID | 3018 |
mRNA Refseq | NM_021062 |
Protein Refseq | NP_066406 |
MIM | 602803 |
UniProt ID | P33778 |
◆ Recombinant Proteins | ||
HIST1H2BB-7662M | Recombinant Mouse HIST1H2BB Protein | +Inquiry |
HIST1H2BB-429H | Recombinant Human HIST1H2BB Protein, MYC/DDK-tagged | +Inquiry |
HIST1H2BB-4189M | Recombinant Mouse HIST1H2BB Protein, His (Fc)-Avi-tagged | +Inquiry |
HIST1H2BB-553H | Recombinant Human HIST1H2BB Protein (2-126 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST1H2BB-5542HCL | Recombinant Human HIST1H2BB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIST1H2BB Products
Required fields are marked with *
My Review for All HIST1H2BB Products
Required fields are marked with *
0
Inquiry Basket