Recombinant Human HIST1H1D protein(2-221aa), MBP&His-tagged

• Cat.No.: HIST1H1D-4422H
• Product Overview: Recombinant Human HIST1H1D protein(P16402)(2-221aa), fused with N-terminal MBP and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&MBP
• Protein Length: 2-221aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 66.0 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: SETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVTKAKKAAPKKK

Gene Information

• Gene Name: HIST1H1D histone cluster 1, H1d [ Homo sapiens ]
• Official Symbol: HIST1H1D
• Synonyms: HIST1H1D; histone cluster 1, H1d; H1 histone family, member 3 , H1F3, histone 1, H1d; histone H1.3; H1.3; H1d; H1s 2; histone H1c; histone 1, H1d; H1 histone family, member 3; H1D; H1F3; MGC138176
• Gene ID: 3007
• mRNA Refseq: NM_005320
• Protein Refseq: NP_005311
• MIM: 142210
• UniProt ID: P16402