Recombinant Human HIPK3 Protein, GST-tagged

• Cat.No.: HIPK3-4765H
• Product Overview: Human HIPK3 partial ORF ( NP_005725, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HIPK3 (Homeodomain Interacting Protein Kinase 3) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is HIPK2.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.19 kDa
• AA Sequence: MASQVLVYPPYVYQTQSSAFCSVKKLKVEPSSCVFQERNYPRTYVNGRNFGNSHPPTKGSAFQTKIPFNRPRGHNFSLQTSAVVLKNTAGATKVI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HIPK3 homeodomain interacting protein kinase 3 [ Homo sapiens ]
• Official Symbol: HIPK3
• Synonyms: HIPK3; homeodomain interacting protein kinase 3; homeodomain-interacting protein kinase 3; DYRK6; FIST3; PKY; YAK1; ANPK; FIST; homolog of protein kinase YAK1; fas-interacting serine/threonine-protein kinase; androgen receptor-interacting nuclear protein kinase
• Gene ID: 10114
• mRNA Refseq: NM_001048200
• Protein Refseq: NP_001041665
• MIM: 604424
• UniProt ID: Q9H422