Recombinant Human HINT1 protein, His-tagged

• Cat.No.: HINT1-29319TH
• Product Overview: Recombinant Human HINT1 protein(1-126 aa), fused with His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-126 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: HINT1 histidine triad nucleotide binding protein 1 [ Homo sapiens ]
• Official Symbol: HINT1
• Synonyms: HINT1; histidine triad nucleotide binding protein 1; HINT, histidine triad nucleotide binding protein , PRKCNH1; histidine triad nucleotide-binding protein 1; PKCI 1; protein kinase C inhibitor 1; adenosine 5-monophosphoramidase; protein kinase C-interacting protein 1; HINT; PKCI-1; PRKCNH1; FLJ30414; FLJ32340
• Gene ID: 3094
• mRNA Refseq: NM_005340
• Protein Refseq: NP_005331
• MIM: 601314
• UniProt ID: P49773