Recombinant Human HIF1A protein, GST-tagged

Cat.No. : HIF1A-198H
Product Overview : Recombinant Human HIF1A(574-799aa) fused with GST tag at N-terminal was expressed in E. coli.
Availability April 19, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 574-799aa
Form : Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
AA Sequence : LRSFDQLSPLESSSASPESASPQSTVTVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIH KETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKME HDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSY D
Purity : > 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping : The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) [ Homo sapiens ]
Official Symbol HIF1A
Synonyms HIF1A; hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); hypoxia-inducible factor 1-alpha; bHLHe78; HIF 1alpha; HIF1; MOP1; PASD8; HIF-1-alpha; member of PAS protein 1; ARNT interacting protein; ARNT-interacting protein; member of PAS superfamily 1; PAS domain-containing protein 8; basic-helix-loop-helix-PAS protein MOP1; class E basic helix-loop-helix protein 78; hypoxia-inducible factor 1 alpha isoform I.3; hypoxia-inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); HIF-1alpha; HIF1-ALPHA;
Gene ID 3091
mRNA Refseq NM_001243084
Protein Refseq NP_001230013
MIM 603348
UniProt ID Q16665
Chromosome Location 14q23.2
Pathway Adipogenesis, organism-specific biosystem; Angiogenesis, organism-specific biosystem; Circadian Clock, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; Hypoxic and oxygen homeostasis regulation of HIF-1-alpha, organism-specific biosystem; NOTCH1 Intracellular Domain Regulates Transcription, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem;
Function Hsp90 protein binding; histone acetyltransferase binding; histone deacetylase binding; protein binding; protein heterodimerization activity; protein heterodimerization activity; protein kinase binding; contributes_to sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; contributes_to sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; signal transducer activity; transcription factor binding; transcription regulatory region DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HIF1A Products

Required fields are marked with *

My Review for All HIF1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon