Recombinant Human HHATL Protein, GST-tagged

• Cat.No.: HHATL-4499H
• Product Overview: Human GUP1 partial ORF ( NP_065758.2, 157 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HHATL (Hedgehog Acyltransferase-Like) is a Protein Coding gene. Diseases associated with HHATL include Skin Squamous Cell Carcinoma. An important paralog of this gene is HHAT.
• Molecular Mass: 31.24 kDa
• AA Sequence: LISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLAD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HHATL hedgehog acyltransferase-like [ Homo sapiens ]
• Official Symbol: HHATL
• Synonyms: GUP1; OACT3; C3orf3; MBOAT3; MSTP002
• Gene ID: 57467
• mRNA Refseq: NM_020707
• Protein Refseq: NP_065758
• MIM: 608116
• UniProt ID: Q9HCP6