Recombinant Human HGSNAT Protein, GST-tagged

• Cat.No.: HGSNAT-4734H
• Product Overview: Human HGSNAT full-length ORF ( AAH12452.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a lysosomal acetyltransferase, which is one of several enzymes involved in the lysosomal degradation of heparin sulfate. Mutations in this gene are associated with Sanfilippo syndrome C, one type of the lysosomal storage disease mucopolysaccaridosis III, which results from impaired degradation of heparan sulfate. [provided by RefSeq
• Molecular Mass: 48.7 kDa
• AA Sequence: MALGLCRCFHPRHSMAAFGLFPALPSALNSHPACTCLLDPSTWRPAHVSGPALASSPQILSVFSLGFPGFVNGSCVSRYKPDIIFPPGLPPPDLPSSVSIFYLQLLCSHGHCCITESGPLLSFSNWPPSLVPHFLKSPVHCHQIKLSPARSPLSEKPPLTWKHHCLAHILTYSPSRLDPHTSFQPPLPLHSLLPPPPPHPLVSPPL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HGSNAT heparan-alpha-glucosaminide N-acetyltransferase [ Homo sapiens (human) ]
• Official Symbol: HGSNAT
• Synonyms: HGSNAT; heparan-alpha-glucosaminide N-acetyltransferase; RP73; HGNAT; MPS3C; TMEM76; heparan-alpha-glucosaminide N-acetyltransferase; transmembrane protein 76; EC 2.3.1.78
• Gene ID: 138050
• mRNA Refseq: NM_152419
• Protein Refseq: NP_689632
• MIM: 610453
• UniProt ID: Q68CP4