Recombinant Human HGF protein, His-tagged

• Cat.No.: HGF-790H
• Product Overview: Recombinant Human EWSR1 protein(Q01844)(Gly221-Leu440), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Gly221-Leu440
• Tag: C-His
• Form: Phosphate buffered saline
• Molecular Mass: 26 kDa
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: GQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKL

Gene Information

• Gene Name: EWSR1 Ewing sarcoma breakpoint region 1 [ Homo sapiens ]
• Official Symbol: EWSR1
• Synonyms: EWSR1; Ewing sarcoma breakpoint region 1; RNA-binding protein EWS; EWS; Ewings sarcoma EWS-Fli1 (type 1) oncogene; bK984G1.4
• Gene ID: 2130
• mRNA Refseq: NM_001163285
• Protein Refseq: NP_001156757
• MIM: 133450
• UniProt ID: Q01844