Recombinant Full Length Rat Hereditary Hemochromatosis Protein Homolog(Hfe) Protein, His-Tagged
Cat.No. : | RFL25073RF |
Product Overview : | Recombinant Full Length Rat Hereditary hemochromatosis protein homolog(Hfe) Protein (O35799) (26-360aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (26-360) |
Form : | Lyophilized powder |
AA Sequence : | QALRPGSHSLRYLFMGASKPDLGLPFFEALGYVDDQLFVSYNHESRRAEPRAPWILGQTSSQLWLQLSQSLKGWDYMFIVDFWTIMGNYNHSKVTKLRVVPESHILQVILGCEVHEDNSTSGFWKYGYDGQDHLEFCPKTLNWSAAEPRAWATKMEWEEHRIRARQSRDYLQRDCPQQLKQVLELQRGVLGQQVPTLVKVTRHWASTGTSLRCQALNFFPQNITMRWLKDSQPLDAKDVNPENVLPNGDGTYQGWLTLAVAPGEETRFSCQVEHPGLDQPLTATWEPSRSQDMIIGIISGITICAIFFVGILILVLRKRKVSGGTMGDYVLTECE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Hfe |
Synonyms | Hfe; Hereditary hemochromatosis protein homolog; RT1-CAFE |
UniProt ID | O35799 |
◆ Recombinant Proteins | ||
HFE-206H | Recombinant Human HFE Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
HFE-1231H | Recombinant Human HFE Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Hfe-1120M | Recombinant Mouse Hfe Protein, MYC/DDK-tagged | +Inquiry |
HFE-4144M | Recombinant Mouse HFE Protein, His (Fc)-Avi-tagged | +Inquiry |
HFE-455HFL | Recombinant Full Length Human HFE Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HFE-5572HCL | Recombinant Human HFE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Hfe Products
Required fields are marked with *
My Review for All Hfe Products
Required fields are marked with *
0
Inquiry Basket