Recombinant Human HEXIM2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HEXIM2-2599H |
Product Overview : | HEXIM2 MS Standard C13 and N15-labeled recombinant protein (NP_653209) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the HEXIM family of proteins. This protein is a component of the 7SK small nuclear ribonucleoprotein. This protein has been found to negatively regulate the kinase activity of the cyclin-dependent kinase P-TEFb, which phosphorylates multiple target proteins to promote transcriptional elongation. This gene is located approximately 7 kb downstream from related family member HEXIM1 on chromosome 17. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 32.4 kDa |
AA Sequence : | MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGAVGGLGWNSRSPRTQSPGGCSAEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPVAPYNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSKQELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HEXIM2 hexamethylene bis-acetamide inducible 2 [ Homo sapiens (human) ] |
Official Symbol | HEXIM2 |
Synonyms | HEXIM2; hexamethylene bis-acetamide inducible 2; protein HEXIM2; FLJ32384; MAQ1 paralog; hexamthylene bis-acetamide inducible 2; hexamethylene bis-acetamide-inducible protein 2; hexamethylene-bis-acetamide-inducible transcript 2; L3; |
Gene ID | 124790 |
mRNA Refseq | NM_144608 |
Protein Refseq | NP_653209 |
MIM | 615695 |
UniProt ID | Q96MH2 |
◆ Recombinant Proteins | ||
HEXIM2-1893R | Recombinant Rhesus Macaque HEXIM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HEXIM2-1089H | Recombinant Human HEXIM2 Protein, MYC/DDK-tagged | +Inquiry |
HEXIM2-2599H | Recombinant Human HEXIM2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HEXIM2-2072R | Recombinant Rhesus monkey HEXIM2 Protein, His-tagged | +Inquiry |
HEXIM2-3527HF | Recombinant Full Length Human HEXIM2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HEXIM2 Products
Required fields are marked with *
My Review for All HEXIM2 Products
Required fields are marked with *
0
Inquiry Basket