Recombinant Human HES7 Protein, GST-tagged

• Cat.No.: HES7-4707H
• Product Overview: Human HES7 full-length ORF ( NP_115969.2, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the hairy and enhancer of split family of bHLH transcription factors. The mouse ortholog of this gene is regulated by Notch signaling. The protein functions as a transcriptional repressor, and is implicated in correct patterning of the axial skeleton. A mutation in this gene has been shown to result in spondylocostal dysostosis. Multiple transcript variants encoding different isoforms have been found for this gene
• Molecular Mass: 51.15 kDa
• AA Sequence: MVTRDRAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERSRVEPPGVPRSPVQDAEALASCYLSGFRECLLRLAAFAHDASPAARAQLFSALHGYLRPKPPRPKPVDPRPPAPRPSLDPAAPALGPALHQRPPVHQGHPSPRCAWSPSLCSPRAGDSGAPAPLTGLLPPPPPPHRQDGAPKAPLPPPPAFWRPWP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HES7 hairy and enhancer of split 7 (Drosophila) [ Homo sapiens ]
• Official Symbol: HES7
• Synonyms: HES7; hairy and enhancer of split 7 (Drosophila); transcription factor HES-7; bHLH factor Hes7; bHLHb37; hHes7; class B basic helix-loop-helix protein 37; SCDO4
• Gene ID: 84667
• mRNA Refseq: NM_001165967
• Protein Refseq: NP_001159439
• MIM: 608059
• UniProt ID: Q9BYE0